Zum Inhalt springen

LL-37

aus Wikipedia, der freien Enzyklopädie
{{#if: [LL-37, 37 aa] | {{#if: 2K6O| {{#if:1472| {{#if: 37 Aminosäuren | {{#if: | {{#if: | {{#if: (170 Aminosäuren) | {{#if: | {{#if: CAMPP49913600474 | {{#if: CAMP | {{#if: P49913600474 | {{#if: | {{#if:| {{#if: 1.C.33.1.10| {{#if: | {{#if: | {{#if: | {{#if: | {{#if: | {{#if: | {{#if: | {{#if: Wirbeltiere<ref>Suchergebnis Cathelicidine nach Taxonomie</ref>{{#if: P49913 | {{#ifeq: NV | NV ||1}}|}}| {{#if: P49913 | {{#ifeq: NV | NV || | style="background:#C3FDB8; color:#000000;" | Homologie-Familie {{#if: Wirbeltiere<ref>Suchergebnis Cathelicidine nach Taxonomie</ref> | | style="background:#C3FDB8; color:#000000;" | Übergeordnetes Taxon {{#if: | | style="background:#C3FDB8; color:#000000;" | Ausnahmen {{#if: {{#if: Hausmaus | | colspan="3" style="background:#90EE90; color:#202122; text-align:center;" | Orthologe {{#if: ENSG00000164047ENSMUSG00000038357
{{#if: | | LL-37 }}
LL-37 }}
3D-Strukturmodell von LL-37
[[Hilfe:Cache|Fehler beim Thumbnail-Erstellen]]:
Andere Namen

[LL-37, 37 aa] }}

Vorhandene Strukturdaten: 2K6O }}

Eigenschaften des menschlichen Proteins

}}

Masse/Länge Primärstruktur 37 Aminosäuren

}}

Sekundär- bis Quartärstruktur

}}

Kofaktor

}}

Präkursor (170 Aminosäuren)

}}

Isoformen

}}

Bezeichner
{{#if: | Gen-Namen | Gen-Name}} | Gen-Name(n) }} {{#if:1472 | CAMP | CAMP}}{{#if: |, }} }}
Externe IDs

{{#if: |

0 | }} - = – valid|1|2=/^[1-9]%d?%d?%d?%d?%d?%d?%d?%d?$/ 0 | Wikipedia:Vorlagenfehler/Vorlage:PubChem}} template= Vorlage:PubChem format=

}} }}{{#invoke:TemplatePar|check

all= 1= opt= 2= 0 | Wikipedia:Vorlagenfehler/Vorlage:PubChem}} template= Vorlage:PubChem format=

}}{{#if: {{#invoke:Wikidata|pageId}}||{{#ifeq: 0 | 0 | }} }}}}{{#if: | 

 }}

}}

Arzneistoffangaben
ATC-Code 
 }}
 {{#if:|
DrugBank [2] 
 }}
 {{#if:|
Wirkstoffklasse 
 }}

}}

Transporter-Klassifikation
TCDB 1.C.33.1.10 
 {{#if: Cathelicidin-Familie (Porine)|
Bezeichnung Cathelicidin-Familie (Porine) 
 }}

}}

{{#if:|Inhibitorklassifikation|{{#if:|Enzymklassifikationen|Enzymklassifikation}}}}
EC, Kategorie {{#if:| [3]}}{{#if: |, [[]]}} }}
MEROPS [4]}}
MEROPS [5]}}
Reaktionsart 
 }}
Substrat 
 }}
Produkte 
 }}


}}

Vorkommen
{{#if: NV|Hovergen}}] NV|Hovergen}}]}} }} }}
Wirbeltiere<ref>Suchergebnis Cathelicidine nach Taxonomie</ref> }}
}}

}}

Mensch Hausmaus
Entrez 
 {{ #if: 820
820 }} 
 {{ #if: 12796
12796 }}
style="background:#C3FDB8; color:#202122;" | Ensembl 
    {{ #if: ENSG00000164047
ENSG00000164047 }} 
    {{ #if: ENSMUSG00000038357
ENSMUSG00000038357 }}

} 

 |-
 | style="background:#C3FDB8; color:#202122;" | UniProt
 {{ #if: P49913
    | | {{#if: kurz| | UniProt }} {{#if:|{{{titel}}}|P49913}}{{#if:|Vorlage:Abrufdatum}}
    | |  }}
 {{ #if: P51437
    | | {{#if: kurz| | UniProt }} {{#if:|{{{titel}}}|P51437}}{{#if:|Vorlage:Abrufdatum}}
    | |  }}
 |-
 {{#if: NM_004345NM_009921
    | | style="background:#C3FDB8; color:#202122;" | Refseq (mRNA)
      {{ #if: NM_004345
         | | NM_004345
         | |  }}
      {{ #if: NM_009921
         | | NM_009921
         | |  }}
    |}}
 |-
 {{#if: NP_004336NP_034051
    | | style="background:#C3FDB8; color:#202122;" | Refseq (Protein)
      {{ #if: NP_004336
         | | NP_004336
         | |  }}
      {{ #if: NP_034051
         | | NP_034051
         | |  }}
    |}}
 |-
 {{#if: 348223347482254919109847377109849456
    | | style="background:#C3FDB8; color:#202122;" | Genlocus
      {{#if: 3 
        | {{#if: 48223347 
            | {{#if: 48225491 
                | |  #if:  |?db=|}}&position=chr3:48223347-48225491 Chr 3: {{#expr: 48223347 / 1000000 round 2}} – {{#expr: 48225491 / 1000000 round 2}} Mb 
                | |  }}
            | |  }}
        | |  }}
      {{#if: 9 
        | {{#if: 109847377 
            | {{#if: 109849456 
                | |  #if:  |?db=|}}&position=chr9:109847377-109849456 Chr 9: {{#expr: 109847377 / 1000000 round 2}} – {{#expr: 109849456 / 1000000 round 2}} Mb 
                | |  }}
           | |  }}
       | |  }}
    |}}
 |-
 | style="background:#C3FDB8; color:#202122;" | PubMed-Suche 
 {{ #if: 820
    | | 820
    | |  }}
 {{ #if: 12796
    | | 12796
    | |  }}

| |- | colspan="3" style="background:#90EE90; color:#202122; text-align:center;" | Orthologe (Mensch) |- | style="background:#C3FDB8; color:#202122;" | Entrez | colspan="2" | 820 

 {{#if: ENSG00000164047
    | |-

| style="background:#C3FDB8; color:#202122;" | Ensembl | colspan="2" | ENSG00000164047 }} |- | style="background:#C3FDB8; color:#202122;" | UniProt | colspan="2" | {{#if: kurz| | UniProt }} {{#if:|{{{titel}}}|P49913}}{{#if:|Vorlage:Abrufdatum}} 

 {{#if: NM_004345
    | |-

| style="background:#C3FDB8; color:#202122;" | Refseq (mRNA) | colspan="2" | NM_004345 }} 

 {{#if: NP_004336
    | |-

| style="background:#C3FDB8; color:#202122;" | Refseq (Protein) | colspan="2" | NP_004336 }} 

 {{#if: 3 
   | {{#if: 48223347 
       | {{#if: 48225491 
           | |-

| style="background:#C3FDB8; color:#202122;" | Genlocus | colspan="2" | #if: |?db=|}}&position=chr3:48223347-48225491 Chr 3: {{#expr: 48223347 / 1000000 round 2}} – {{#expr: 48225491 / 1000000 round 2}} Mb 

           |  }}
       |  }}
   |  }}

|- | style="background:#C3FDB8; color:#202122;" | PubMed-Suche | colspan="2" | 820 }} {{#if: Hausmaus 

    | {{#if: 12796ENSMUSG00000038357NM_009921NP_0340519109847377109849456P51437 
        |
        |  Spezies2= ist definiert, es sind jedoch keine weiteren Angaben zu Spezies2 vorhanden.{{#ifeq:0|0| }} }}
    | {{#if: 12796ENSMUSG00000038357NM_009921NP_0340519109847377109849456P51437 
        |  Es sind Angaben zu Spezies2 vorhanden, Spezies2= ist jedoch nicht definiert.{{#ifeq:0|0| }}
        |}}

}} | {{#if: Hausmaus | | colspan="3" style="background:#90EE90; color:#202122; text-align:center;" | Orthologe 

 |-
 | style="background:#C3FDB8; color:#202122;" |
 | style="background:#C3FDB8; color:#202122; text-align:center;" | Mensch
 | style="background:#C3FDB8; color:#202122; text-align:center;" | Hausmaus
 |-
 | style="background:#C3FDB8; color:#202122;" | Entrez
 {{ #if: 820
    | | 820
    | |  }}
 {{ #if: 12796
    | | 12796
    | |  }}
 |-
 {{#if: ENSG00000164047ENSMUSG00000038357
    | | style="background:#C3FDB8; color:#202122;" | Ensembl
    {{ #if: ENSG00000164047
       || ENSG00000164047
       ||  }}
    {{ #if: ENSMUSG00000038357
       || ENSMUSG00000038357
       ||  }}
  |}}
 |-
 | style="background:#C3FDB8; color:#202122;" | UniProt
 {{ #if: P49913
    | | {{#if: kurz| | UniProt }} {{#if:|{{{titel}}}|P49913}}{{#if:|Vorlage:Abrufdatum}}
    | |  }}
 {{ #if: P51437
    | | {{#if: kurz| | UniProt }} {{#if:|{{{titel}}}|P51437}}{{#if:|Vorlage:Abrufdatum}}
    | |  }}
 |-
 {{#if: NM_004345NM_009921
    | | style="background:#C3FDB8; color:#202122;" | Refseq (mRNA)
      {{ #if: NM_004345
         | | NM_004345
         | |  }}
      {{ #if: NM_009921
         | | NM_009921
         | |  }}
    |}}
 |-
 {{#if: NP_004336NP_034051
    | | style="background:#C3FDB8; color:#202122;" | Refseq (Protein)
      {{ #if: NP_004336
         | | NP_004336
         | |  }}
      {{ #if: NP_034051
         | | NP_034051
         | |  }}
    |}}
 |-
 {{#if: 348223347482254919109847377109849456
    | | style="background:#C3FDB8; color:#202122;" | Genlocus
      {{#if: 3 
        | {{#if: 48223347 
            | {{#if: 48225491 
                | |  #if:  |?db=|}}&position=chr3:48223347-48225491 Chr 3: {{#expr: 48223347 / 1000000 round 2}} – {{#expr: 48225491 / 1000000 round 2}} Mb 
                | |  }}
            | |  }}
        | |  }}
      {{#if: 9 
        | {{#if: 109847377 
            | {{#if: 109849456 
                | |  #if:  |?db=|}}&position=chr9:109847377-109849456 Chr 9: {{#expr: 109847377 / 1000000 round 2}} – {{#expr: 109849456 / 1000000 round 2}} Mb 
                | |  }}
           | |  }}
       | |  }}
    |}}
 |-
 | style="background:#C3FDB8; color:#202122;" | PubMed-Suche 
 {{ #if: 820
    | | 820
    | |  }}
 {{ #if: 12796
    | | 12796
    | |  }}

| |- | colspan="3" style="background:#90EE90; color:#202122; text-align:center;" | Orthologe (Mensch) |- | style="background:#C3FDB8; color:#202122;" | Entrez | colspan="2" | 820 

 {{#if: ENSG00000164047
    | |-

| style="background:#C3FDB8; color:#202122;" | Ensembl | colspan="2" | ENSG00000164047 }} |- | style="background:#C3FDB8; color:#202122;" | UniProt | colspan="2" | {{#if: kurz| | UniProt }} {{#if:|{{{titel}}}|P49913}}{{#if:|Vorlage:Abrufdatum}} 

 {{#if: NM_004345
    | |-

| style="background:#C3FDB8; color:#202122;" | Refseq (mRNA) | colspan="2" | NM_004345 }} 

 {{#if: NP_004336
    | |-

| style="background:#C3FDB8; color:#202122;" | Refseq (Protein) | colspan="2" | NP_004336 }} 

 {{#if: 3 
   | {{#if: 48223347 
       | {{#if: 48225491 
           | |-

| style="background:#C3FDB8; color:#202122;" | Genlocus | colspan="2" | #if: |?db=|}}&position=chr3:48223347-48225491 Chr 3: {{#expr: 48223347 / 1000000 round 2}} – {{#expr: 48225491 / 1000000 round 2}} Mb 

           |  }}
       |  }}
   |  }}

|- | style="background:#C3FDB8; color:#202122;" | PubMed-Suche | colspan="2" | 820 }} {{#if: Hausmaus 

    | {{#if: 12796ENSMUSG00000038357NM_009921NP_0340519109847377109849456P51437 
        |
        |  Spezies2= ist definiert, es sind jedoch keine weiteren Angaben zu Spezies2 vorhanden.{{#ifeq:0|0| }} }}
    | {{#if: 12796ENSMUSG00000038357NM_009921NP_0340519109847377109849456P51437 
        |  Es sind Angaben zu Spezies2 vorhanden, Spezies2= ist jedoch nicht definiert.{{#ifeq:0|0| }}
        |}}

}} }}

|}{{#if:PDB 2k6o EBI.png||}}

LL-37 ist ein menschliches antimikrobielles Peptid aus der Gruppe der Cathelicidine. Es wird hauptsächlich in Immunzellen produziert und ist Teil der angeborenen Immunantwort sowie der Apoptose körpereigener Zellen. Es handelt sich um ein Transportprotein, dessen Einbau einerseits in die Zellwand grampositiver Bakterien sowie andererseits in die Zellmembran zu einem Verlust von Ionen und kleinen Molekülen führt. Es wird durch das CAMP-Gen codiert.<ref>{{#if: | | UniProt }} {{#if:|{{{titel}}}|P49913}}{{#if:|Vorlage:Abrufdatum}}</ref>

Die Produktion von LL-37 wird insbesondere durch Stimulation des TLR-9, aber auch TLR-2 und TLR-4 und indirekt durch Vitamin D angeregt.<ref>{{#invoke:Vorlage:Literatur|f}}{{#if: 

       | {{#if: Vorlage:Cite book/ParamBool
               | Vorlage:Toter Link/archivebot
               | Vorlage:Webarchiv/archiv-bot
         }}
  }}{{#invoke:TemplatePar|check
   |all    = title=
   |opt    = vauthors= author= author1= authorlink= author-link= author-link1= author1-link= author2= author3= author4= author5= author6= author7= author8= author9= editor= last= first= last1= first1= last2= first2= last3= first3= last4= first4= last5= first5= last6= first6= last7= first7= last8= first8= last9= first9= last10= first10= last11= first11= last12= first12= last13= first13= last14= first14= last15= first15= others= script-title= trans-title= date= year= volume= issue= number= series= page= pages= at= issn= arxiv= bibcode= doi= pmid= pmc= jstor= oclc= id= url= url-status= format= access-date= archive-date= archive-url= archivebot= offline= location= publisher= language= quote= work= journal= newspaper= magazine= periodical=  name-list-style= url-access= doi-access= display-authors= via= s2cid= mr= type= citeseerx=  accessdate= archivedate= archiveurl= coauthors= month= day= last16= first16= last17= first17= last18= first18= last19= first19= last20= first20= last21= first21= last22= first22= last23= first23= last24= first24= last25= first25= last26= first26= last27= first27= last28= first28= last29= first29= last30= first30= last31= first31=
   |cat      = Wikipedia:Vorlagenfehler/Vorlage:Cite journal
   |errNS    = 0
   |template = Vorlage:Cite journal
   |format   = 
   |preview  = 1
  }}Vorlage:Cite book/URL{{#if:  | Vorlage:Cite book/Meldung }}{{#if:        | Vorlage:Cite book/Meldung }}{{#if: Infection and Immunity
     || Vorlage:Cite book/Meldung
  }}{{#if: Vorlage:Cite book/ParamBool
        | Vorlage:Cite book/Meldung
  }}{{#if: Vorlage:Cite book/ParamBool
     | Vorlage:Cite book/Meldung
  }}{{#if: Vorlage:Cite book/ParamBool
     | Vorlage:Cite book/Meldung
  }}{{#if: Vorlage:Cite book/ParamBool
     | Vorlage:Cite book/Meldung
  }}{{#if: Vorlage:Cite book/ParamBool
       | Vorlage:Cite book/Meldung
  }}{{#if: Vorlage:Cite book/ParamBool
     | Vorlage:Cite book/Meldung
  }}Vorlage:Cite book/Meldung2{{#ifexpr: 0{{#ifeq:^^|^^||+1}}{{#ifeq:^^|^^||+1}}{{#ifeq:Rivas-Santiago B, Hernandez-Pando R, Carranza C, et al.|^^||+1}}{{#ifeq:^^|^^||+1}} > 1
    | Vorlage:Cite book/Meldung
  }}</ref><ref>{{#invoke:Vorlage:Literatur|f}}{{#if: 
       | {{#if: Vorlage:Cite book/ParamBool
               | Vorlage:Toter Link/archivebot
               | Vorlage:Webarchiv/archiv-bot
         }}
  }}{{#invoke:TemplatePar|check
   |all    = title=
   |opt    = vauthors= author= author1= authorlink= author-link= author-link1= author1-link= author2= author3= author4= author5= author6= author7= author8= author9= editor= last= first= last1= first1= last2= first2= last3= first3= last4= first4= last5= first5= last6= first6= last7= first7= last8= first8= last9= first9= last10= first10= last11= first11= last12= first12= last13= first13= last14= first14= last15= first15= others= script-title= trans-title= date= year= volume= issue= number= series= page= pages= at= issn= arxiv= bibcode= doi= pmid= pmc= jstor= oclc= id= url= url-status= format= access-date= archive-date= archive-url= archivebot= offline= location= publisher= language= quote= work= journal= newspaper= magazine= periodical=  name-list-style= url-access= doi-access= display-authors= via= s2cid= mr= type= citeseerx=  accessdate= archivedate= archiveurl= coauthors= month= day= last16= first16= last17= first17= last18= first18= last19= first19= last20= first20= last21= first21= last22= first22= last23= first23= last24= first24= last25= first25= last26= first26= last27= first27= last28= first28= last29= first29= last30= first30= last31= first31=
   |cat      = Wikipedia:Vorlagenfehler/Vorlage:Cite journal
   |errNS    = 0
   |template = Vorlage:Cite journal
   |format   = 
   |preview  = 1
  }}Vorlage:Cite book/URL{{#if:  | Vorlage:Cite book/Meldung }}{{#if:        | Vorlage:Cite book/Meldung }}{{#if: Cell Host Microbe
     || Vorlage:Cite book/Meldung
  }}{{#if: Vorlage:Cite book/ParamBool
        | Vorlage:Cite book/Meldung
  }}{{#if: Vorlage:Cite book/ParamBool
     | Vorlage:Cite book/Meldung
  }}{{#if: Vorlage:Cite book/ParamBool
     | Vorlage:Cite book/Meldung
  }}{{#if: Vorlage:Cite book/ParamBool
     | Vorlage:Cite book/Meldung
  }}{{#if: Vorlage:Cite book/ParamBool
       | Vorlage:Cite book/Meldung
  }}{{#if: Vorlage:Cite book/ParamBool
     | Vorlage:Cite book/Meldung
  }}Vorlage:Cite book/Meldung2{{#ifexpr: 0{{#ifeq:^^|^^||+1}}{{#ifeq:^^|^^||+1}}{{#ifeq:Yuk JM, Shin DM, Lee HM, et al.|^^||+1}}{{#ifeq:^^|^^||+1}} > 1
    | Vorlage:Cite book/Meldung
  }}</ref>

Biosynthese

Die Biosynthese von LL-37 ist ein mehrstufiger Prozess. Es wird durch das CAMP-Gen auf Chromosom 3 codiert. Dieses Gen besteht, wie auch die Cathelicidin-Gene anderer Säugetiere, aus vier Exons. Die antimikrobielle Aktivität wird durch das hypervariable Exon 4 codiert, während die Exons 1 bis 3 eine Signalpeptidsequenz und die darauf folgende Cathelin-Domäne codieren.<ref name="Tomasinsig L & Zanetti M (2005)">{{#invoke:Vorlage:Literatur|f}}{{#if: 

       | {{#if: Vorlage:Cite book/ParamBool
               | Vorlage:Toter Link/archivebot
               | Vorlage:Webarchiv/archiv-bot
         }}
  }}{{#invoke:TemplatePar|check
   |all    = title=
   |opt    = vauthors= author= author1= authorlink= author-link= author-link1= author1-link= author2= author3= author4= author5= author6= author7= author8= author9= editor= last= first= last1= first1= last2= first2= last3= first3= last4= first4= last5= first5= last6= first6= last7= first7= last8= first8= last9= first9= last10= first10= last11= first11= last12= first12= last13= first13= last14= first14= last15= first15= others= script-title= trans-title= date= year= volume= issue= number= series= page= pages= at= issn= arxiv= bibcode= doi= pmid= pmc= jstor= oclc= id= url= url-status= format= access-date= archive-date= archive-url= archivebot= offline= location= publisher= language= quote= work= journal= newspaper= magazine= periodical=  name-list-style= url-access= doi-access= display-authors= via= s2cid= mr= type= citeseerx=  accessdate= archivedate= archiveurl= coauthors= month= day= last16= first16= last17= first17= last18= first18= last19= first19= last20= first20= last21= first21= last22= first22= last23= first23= last24= first24= last25= first25= last26= first26= last27= first27= last28= first28= last29= first29= last30= first30= last31= first31=
   |cat      = Wikipedia:Vorlagenfehler/Vorlage:Cite journal
   |errNS    = 0
   |template = Vorlage:Cite journal
   |format   = 
   |preview  = 1
  }}Vorlage:Cite book/URL{{#if:  | Vorlage:Cite book/Meldung }}{{#if:        | Vorlage:Cite book/Meldung }}{{#if: Curr. Protein Pept. Sci.
     || Vorlage:Cite book/Meldung
  }}{{#if: Vorlage:Cite book/ParamBool
        | Vorlage:Cite book/Meldung
  }}{{#if: Vorlage:Cite book/ParamBool
     | Vorlage:Cite book/Meldung
  }}{{#if: Vorlage:Cite book/ParamBool
     | Vorlage:Cite book/Meldung
  }}{{#if: Vorlage:Cite book/ParamBool
     | Vorlage:Cite book/Meldung
  }}{{#if: Vorlage:Cite book/ParamBool
       | Vorlage:Cite book/Meldung
  }}{{#if: Vorlage:Cite book/ParamBool
     | Vorlage:Cite book/Meldung
  }}Vorlage:Cite book/Meldung2{{#ifexpr: 0{{#ifeq:^^|^^||+1}}{{#ifeq:^^|^^||+1}}{{#ifeq:Tomasinsig L, Zanetti M|^^||+1}}{{#ifeq:^^|^^||+1}} > 1
    | Vorlage:Cite book/Meldung
  }}</ref>

Primär wird ein Präpropeptide synthetisiert und in den Granula neutrophiler Granulozyten oder anderer Zellen gespeichert. Nach Freisetzung dieser biologisch inaktiven Propeptide werden sie enzymatisch durch Elastase oder andere Proteinasen in ein Cathelin und ein C-terminales antimikrobielles Peptid, das aus 37 Aminosäuren bestehende LL-37, gespalten.

Im Einbuchstabencode lautet die Peptidsequenz von LL-37 [LL-37, 37 aa]<ref name="PMID19917670">A. Pini, C. Falciani u. a.: A novel tetrabranched antimicrobial peptide that neutralizes bacterial lipopolysaccharide and prevents septic shock in vivo. In: FASEB journal. Band 24, Nummer 4, April 2010, S. 1015–1022, {{#invoke:URIutil|{{#ifeq:1|1|linkISSN|targetISSN}}|1530-6860|0}}{{#ifeq:1|0|[!] }}{{#ifeq:0|1 

        |{{#switch:00
                  |11= (print/online)
                  |10= (print)
                  |01= (online)
          }}

}}{{#ifeq:0|0 

        |{{#ifeq:0|0
              |{{#if:{{#invoke:URIutil|isISSNvalid|1=1530-6860}}
                    |
                    |{{#invoke:TemplUtl|failure|ISSN ungültig}}}}}}

}}. {{#invoke:Vorlage:Handle|f|scheme=doi|class=plainlinks|parProblem=Problem|errCat=Wikipedia:Vorlagenfehler/Parameter:DOI|errClasses=error editoronly|errHide=1|errNS=0 4 10 100}}. PMID 19917670.</ref>

Literatur

{{#invoke:Vorlage:Literatur|f}}{{#if: 

       | {{#if: Vorlage:Cite book/ParamBool
               | Vorlage:Toter Link/archivebot
               | Vorlage:Webarchiv/archiv-bot
         }}
  }}{{#invoke:TemplatePar|check
   |all    = title=
   |opt    = vauthors= author= author1= authorlink= author-link= author-link1= author1-link= author2= author3= author4= author5= author6= author7= author8= author9= editor= last= first= last1= first1= last2= first2= last3= first3= last4= first4= last5= first5= last6= first6= last7= first7= last8= first8= last9= first9= last10= first10= last11= first11= last12= first12= last13= first13= last14= first14= last15= first15= others= script-title= trans-title= date= year= volume= issue= number= series= page= pages= at= issn= arxiv= bibcode= doi= pmid= pmc= jstor= oclc= id= url= url-status= format= access-date= archive-date= archive-url= archivebot= offline= location= publisher= language= quote= work= journal= newspaper= magazine= periodical=  name-list-style= url-access= doi-access= display-authors= via= s2cid= mr= type= citeseerx=  accessdate= archivedate= archiveurl= coauthors= month= day= last16= first16= last17= first17= last18= first18= last19= first19= last20= first20= last21= first21= last22= first22= last23= first23= last24= first24= last25= first25= last26= first26= last27= first27= last28= first28= last29= first29= last30= first30= last31= first31=
   |cat      = Wikipedia:Vorlagenfehler/Vorlage:Cite journal
   |errNS    = 0
   |template = Vorlage:Cite journal
   |format   = 
   |preview  = 1
  }}Vorlage:Cite book/URL{{#if:  | Vorlage:Cite book/Meldung }}{{#if:        | Vorlage:Cite book/Meldung }}{{#if: Curr Issues Mol Biol
     || Vorlage:Cite book/Meldung
  }}{{#if: Vorlage:Cite book/ParamBool
        | Vorlage:Cite book/Meldung
  }}{{#if: Vorlage:Cite book/ParamBool
     | Vorlage:Cite book/Meldung
  }}{{#if: Vorlage:Cite book/ParamBool
     | Vorlage:Cite book/Meldung
  }}{{#if: Vorlage:Cite book/ParamBool
     | Vorlage:Cite book/Meldung
  }}{{#if: Vorlage:Cite book/ParamBool
       | Vorlage:Cite book/Meldung
  }}{{#if: Vorlage:Cite book/ParamBool
     | Vorlage:Cite book/Meldung
  }}Vorlage:Cite book/Meldung2{{#ifexpr: 0{{#ifeq:^^|^^||+1}}{{#ifeq:^^|^^||+1}}{{#ifeq:Zanetti M|^^||+1}}{{#ifeq:^^|^^||+1}} > 1
    | Vorlage:Cite book/Meldung
  }}

Einzelnachweise

<references />

Abgerufen von „https://wiki-de.moshellshocker.dns64.de/index.php?title=LL-37&oldid=2213087“